Công ty TNHH Công nghệ sinh học Thâm Quyến Haiwen là một nhà sản xuất bột thô, dầu bán thành phẩm, chất lỏng thành phẩm, HGH, peptide và thuốc uống ANESTHETIC tại Trung Quốc.

doanh số bán hàng
Yêu cầu báo giá -
Select Language
Nhà
Sản phẩm
Về chúng tôi
Tham quan nhà máy
Kiểm soát chất lượng
Liên hệ chúng tôi
Yêu cầu báo giá
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
NhàSản phẩm

steroids for hair growth

Tôi đã nhận được sản phẩm của tôi, bạn đóng gói là kín đáo và hoàn hảo, nó thực sự làm tôi ngạc nhiên. Tôi sẽ đặt hàng nhiều hơn từ bạn càng sớm càng tốt. Tks!

—— Robet--Australia

Tôi đã hợp tác với bạn nhiều lần, chất lượng sản phẩm của bạn rất tuyệt vời, đó là lý do tại sao tôi vẫn mua sản phẩm từ bạn. cảm ơn bạn

—— Richard---American

Chào bạn, giá tốt nhất và sản phẩm có độ tinh khiết cao của bạn rất cạnh tranh ở đất nước tôi, điều này cho tôi kiếm được nhiều lợi nhuận, khách hàng của tôi thực sự thích nó.

—— Johnson---Canada

Tôi trò chuyện trực tuyến bây giờ

steroids for hair growth

(228)

Thuốc điều trị rụng tóc Minoxidil 99% Min Thuốc mọc tóc 38304-91-5

Thuốc điều trị rụng tóc Minoxidil 99% Min Thuốc mọc tóc 38304-91-5 1. Mô tả cơ bản: Minoxidil là thuốc giãn mạch chống tăng huyết áp. Nó cũng làm chậm hoặc ngừng rụng tóc và thúc đẩy mọc lại tóc. Bây giờ không ...Đọc thêm
2019-03-13 17:06:04

Tinh thể trắng Tăng trưởng tóc rắn Steroid Finasteride Proscar Anti-estrogen Steroid

Tinh thể trắng Tăng trưởng tóc rắn Steroid Finasteride Proscar Anti-estrogen Steroid Chi tiết nhanh: Tên sản phẩm: Finasteride Bí danh: Proscar CAS: 98319-26-7 MF: C23H36N2O2 MW: 372,55 Độ tinh khiết: 99,68% ...Đọc thêm
2019-03-13 17:06:20

Thuốc trị rụng tóc Thuốc Minoxidil Độ tinh khiết 99% Min Thuốc mọc tóc CAS 38304-91-5

Thuốc điều trị rụng tóc Minoxidil 99% Min Thuốc mọc tóc 38304-91-5 1. Mô tả cơ bản: Minoxidil là thuốc giãn mạch chống tăng huyết áp. Nó cũng làm chậm hoặc ngừng rụng tóc và thúc đẩy mọc lại tóc. Bây giờ không ...Đọc thêm
2019-03-13 17:06:13

Testosterone Enanthate bột tăng trưởng tóc Hormone BodyBu dựng 315-37-7

Testosterone Enanthate bột tăng trưởng tóc Hormone BodyBu dựng 315-37-7 1. Chi tiết nhanh: Tên sản phẩm Cung cấp nhà máy Testosterone Enanthate Tên khác Testosterone enantate; testosterone enthanoate; ...Đọc thêm
2019-03-13 17:06:15

Thuốc tăng trưởng tóc gây mê Proscar Anodyne 98319-26-7 Finasteride, Prostide

Bột tăng trưởng tóc An toàn Proscar Thuốc gây tê tại chỗ Anodyne CAS 98319-26-7 Finasteride, Prostide 1. Chi tiết nhanh: Tên sản phẩm Cung cấp nhà máy Formestane Tên khác Đậu lăng; 4-hydroxy-androst-4-ene-17...Đọc thêm
2019-03-13 17:06:14

Dutasteride Hair Steroid Hormone Powder Avodart để điều trị rụng tóc

Tự giới thiệu: Công ty chúng tôi đã làm dòng này hơn 10 năm, chúng tôi có kinh nghiệm với sản phẩm đặc biệt, vận chuyển an toàn và thành công cao cho hải quan thông qua, chào mừng bạn đến đây để tham khảo: ...Đọc thêm
2019-03-13 17:06:06

Dutasteride Avodart Tăng trưởng tóc Steroid 99% Pharma Lớp 164656-23-9

Dutasteride Avodart Tăng trưởng tóc Steroid 99% Pharma Lớp 164656-23-9 Mô tả cơ bản: Dutasteride (Avodart), được sản xuất bởi GlaxoSmithKline, là một chất ức chế men khử 5-α kép có tác dụng ức chế chuyển đổi ...Đọc thêm
2019-03-13 17:06:13

Điều trị tuyến tiền liệt mở rộng Steroid 164656-23-9 Duagen

Điều trị tuyến tiền liệt mở rộng Steroid 164656-23-9 Duagen 1. Chi tiết nhanh: Dutasteride Bí danh: Avodart; Duagen CAS SỐ: 164656-23-9 MF: C27H30F6N 2 O 2 MW: 528,53 Độ tinh khiết: 99% Ngoại hình: phấn trắng. ...Đọc thêm
2019-03-13 17:06:15

Finasteride Tăng trưởng tóc Steroid Hormone Powder Proscar / Propecia

Tự giới thiệu: Công ty chúng tôi đã làm dòng này hơn 10 năm, chúng tôi có kinh nghiệm với sản phẩm đặc biệt, vận chuyển an toàn và thành công cao cho hải quan thông qua, chào mừng bạn đến đây để tham khảo: ...Đọc thêm
2019-03-13 17:06:06

Lyophilized Tiêm 2mg / lọ Thuốc mọc tóc Steroid Sermorelin Polypeptide

Lyophilized Tiêm 2mg / lọ Thuốc mọc tóc Steroid Sermorelin Polypeptide Chi tiết nhanh: Tên sản phẩm: Sermorelin Từ đồng nghĩa: SERMORELIN; SERMORELIN ACETATE; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR-ALA-ASP-ALA...Đọc thêm
2019-03-13 17:06:33
Page 1 of 10 |< << 1  2  3  4  5  6  7  8  9  10  >> >|