Công ty TNHH Công nghệ sinh học Huaju là một Nhà sản xuất bột Steroid thô, dầu / viên nén thành phẩm, HGH, HCG, Peptide và THUỐC GIẢI PHẪU ĐỊA PHƯƠNG tại Trung Quốc.

doanh số bán hàng
Yêu cầu báo giá - Email
Select Language
Sản phẩm
Về chúng tôi
Tham quan nhà máy
Kiểm soát chất lượng
Liên hệ chúng tôi
Yêu cầu báo giá
NhàSản phẩm

hair growth steroid

Tôi đã nhận được sản phẩm của tôi, bạn đóng gói là kín đáo và hoàn hảo, nó thực sự làm tôi ngạc nhiên. Tôi sẽ đặt hàng nhiều hơn từ bạn càng sớm càng tốt. Tks!

—— Robet--Australia

Tôi đã hợp tác với bạn nhiều lần, chất lượng sản phẩm của bạn rất tuyệt vời, đó là lý do tại sao tôi vẫn mua sản phẩm từ bạn. cảm ơn bạn

—— Richard---American

Chào bạn, giá tốt nhất và sản phẩm có độ tinh khiết cao của bạn rất cạnh tranh ở đất nước tôi, điều này cho tôi kiếm được nhiều lợi nhuận, khách hàng của tôi thực sự thích nó.

—— Johnson---Canada

Tôi trò chuyện trực tuyến bây giờ

hair growth steroid


Dutasteride Avodart Tăng trưởng tóc Steroid 99% Pharma Lớp 164656-23-9

Dutasteride Avodart Tăng trưởng tóc Steroid 99% Pharma Lớp 164656-23-9 Mô tả cơ bản: Dutasteride (Avodart), được sản xuất bởi GlaxoSmithKline, là một chất ức chế men khử 5-α kép có tác dụng ức chế chuyển đổi ...Đọc thêm
2019-03-13 17:06:13

Chiết xuất thảo dược Potent Tăng trưởng tóc Steroid Minoxidil CAS 38304-91-5

Chiết xuất thảo dược Potent Tăng trưởng tóc Steroid Minoxidil CAS 38304-91-5 Kính gửi, SMQ đã xuất khẩu như vậy sản phẩm trong 12 năm, chất lượng cao với giá tốt và phản hồi nhanh , vui lòng liên hệ với ycsmq...Đọc thêm
2019-03-13 17:06:09

Điều trị tuyến tiền liệt mở rộng Steroid 164656-23-9 Duagen

Điều trị tuyến tiền liệt mở rộng Steroid 164656-23-9 Duagen 1. Chi tiết nhanh: Dutasteride Bí danh: Avodart; Duagen CAS SỐ: 164656-23-9 MF: C27H30F6N 2 O 2 MW: 528,53 Độ tinh khiết: 99% Ngoại hình: phấn trắng. ...Đọc thêm
2019-03-13 17:06:15

Aphrodisiac Peptide Tăng trưởng tóc trắng Steroid PT141 Acetate CAS 32780-32-8

Aphrodisiac Peptide Tăng trưởng tóc trắng Steroid PT141 Acetate CAS 32780-32-8 Chi tiết nhanh: Brasheranotide; PT-141 Số CAS: 32780-32-8 Moq: 20 lọ Độ tinh khiết (HPLC): 98,0% tối thiểu. Công thức phân tử: ...Đọc thêm
2019-03-13 17:06:27

Tăng trưởng tóc khỏe mạnh Steroid 98% Dapoxetine cho tiêu chuẩn doanh nghiệp điều trị PE

Tăng trưởng tóc khỏe mạnh Steroid 98% Dapoxetine cho tiêu chuẩn doanh nghiệp điều trị PE 1. Chi tiết nhanh: 1. CAS số: 119356-77-3 2. MF: C21H23NO 3. MW: 305.4134 4. Khảo nghiệm: 98% 5. Ngoại hình: Bột tinh thể ...Đọc thêm
2019-03-13 17:06:14

Dutasteride Hair Steroid Hormone Powder Avodart để điều trị rụng tóc

Tự giới thiệu: Công ty chúng tôi đã làm dòng này hơn 10 năm, chúng tôi có kinh nghiệm với sản phẩm đặc biệt, vận chuyển an toàn và thành công cao cho hải quan thông qua, chào mừng bạn đến đây để tham khảo: ...Đọc thêm
2019-03-13 17:06:06

Tinh thể trắng Tăng trưởng tóc rắn Steroid Finasteride Proscar Anti-estrogen Steroid

Tinh thể trắng Tăng trưởng tóc rắn Steroid Finasteride Proscar Anti-estrogen Steroid Chi tiết nhanh: Tên sản phẩm: Finasteride Bí danh: Proscar CAS: 98319-26-7 MF: C23H36N2O2 MW: 372,55 Độ tinh khiết: 99,68% ...Đọc thêm
2019-03-13 17:06:20

Thuốc điều trị rụng tóc Minoxidil 99% Min Thuốc mọc tóc 38304-91-5

Thuốc điều trị rụng tóc Minoxidil 99% Min Thuốc mọc tóc 38304-91-5 1. Mô tả cơ bản: Minoxidil là thuốc giãn mạch chống tăng huyết áp. Nó cũng làm chậm hoặc ngừng rụng tóc và thúc đẩy mọc lại tóc. Bây giờ không ...Đọc thêm
2019-03-13 17:06:04

Thuốc trị rụng tóc Thuốc Minoxidil Độ tinh khiết 99% Min Thuốc mọc tóc CAS 38304-91-5

Thuốc điều trị rụng tóc Minoxidil 99% Min Thuốc mọc tóc 38304-91-5 1. Mô tả cơ bản: Minoxidil là thuốc giãn mạch chống tăng huyết áp. Nó cũng làm chậm hoặc ngừng rụng tóc và thúc đẩy mọc lại tóc. Bây giờ không ...Đọc thêm
2019-03-13 17:06:13

Lyophilized Tiêm 2mg / lọ Thuốc mọc tóc Steroid Sermorelin Polypeptide

Lyophilized Tiêm 2mg / lọ Thuốc mọc tóc Steroid Sermorelin Polypeptide Chi tiết nhanh: Tên sản phẩm: Sermorelin Từ đồng nghĩa: SERMORELIN; SERMORELIN ACETATE; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR-ALA-ASP-ALA...Đọc thêm
2019-03-13 17:06:33
Page 1 of 10 |< << 1  2  3  4  5  6  7  8  9  10  >> >|