Công ty TNHH Công nghệ sinh học Huaju là một Nhà sản xuất bột Steroid thô, dầu / viên nén thành phẩm, HGH, HCG, Peptide và THUỐC GIẢI PHẪU ĐỊA PHƯƠNG tại Trung Quốc.

doanh số bán hàng
Yêu cầu báo giá - Email
Select Language
Sản phẩm
Về chúng tôi
Tham quan nhà máy
Kiểm soát chất lượng
Liên hệ chúng tôi
Yêu cầu báo giá
NhàSản phẩm

Bột tăng trưởng tóc

Tôi đã nhận được sản phẩm của tôi, bạn đóng gói là kín đáo và hoàn hảo, nó thực sự làm tôi ngạc nhiên. Tôi sẽ đặt hàng nhiều hơn từ bạn càng sớm càng tốt. Tks!

—— Robet--Australia

Tôi đã hợp tác với bạn nhiều lần, chất lượng sản phẩm của bạn rất tuyệt vời, đó là lý do tại sao tôi vẫn mua sản phẩm từ bạn. cảm ơn bạn

—— Richard---American

Chào bạn, giá tốt nhất và sản phẩm có độ tinh khiết cao của bạn rất cạnh tranh ở đất nước tôi, điều này cho tôi kiếm được nhiều lợi nhuận, khách hàng của tôi thực sự thích nó.

—— Johnson---Canada

Tôi trò chuyện trực tuyến bây giờ

Bột tăng trưởng tóc

China 99,5% Độ tinh khiết cao Minoxidil USP34 Bột tăng trưởng tóc Dược phẩm CAS 38304-91-5 distributor

99,5% Độ tinh khiết cao Minoxidil USP34 Bột tăng trưởng tóc Dược phẩm CAS 38304-91-5

99,5% Độ tinh khiết cao Minoxidil USP34 Bột tăng trưởng tóc Dược phẩm CAS 38304-91-5 Chi tiết nhanh: Minoxidil hoặc Minoxidil sulphate là một loại thuốc giảm huyết áp, làm giảm huyết áp, thúc đẩy mọc tóc bên ...    Đọc thêm
2019-03-13 17:06:34
China Bột mọc tóc BPH Avodart / Dutasteride 164656-23-9 Duagen distributor

Bột mọc tóc BPH Avodart / Dutasteride 164656-23-9 Duagen

Bột mọc tóc BPH Avodart / Dutasteride 164656-23-9 Duagen Dutasteride (Avodart) Tên sản phẩm: Dutasteride Trọng lượng phân tử: L28.5297 InChI: nChI = 1 / C27H30F6N2O2 / c1-24-11-9-17-15 (4-8-21-25 (17,2) 12-10...    Đọc thêm
2019-03-13 17:06:29
China Lyophilized Tiêm 2mg / lọ Thuốc mọc tóc Steroid Sermorelin Polypeptide distributor

Lyophilized Tiêm 2mg / lọ Thuốc mọc tóc Steroid Sermorelin Polypeptide

Lyophilized Tiêm 2mg / lọ Thuốc mọc tóc Steroid Sermorelin Polypeptide Chi tiết nhanh: Tên sản phẩm: Sermorelin Từ đồng nghĩa: SERMORELIN; SERMORELIN ACETATE; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR-ALA-ASP-ALA...    Đọc thêm
2019-03-13 17:06:33
China Thuốc mọc tóc Hongdenafil dạng bột trắng tinh thể CAS 98319-26-7 distributor

Thuốc mọc tóc Hongdenafil dạng bột trắng tinh thể CAS 98319-26-7

Bột mọc tóc Hongdenafil tinh thể trắng CAS 98319-26-7 Chi tiết nhanh: Tên sản phẩm Hongdenafil Tên khác Acetildenafil Số đăng ký CAS 831217-01-7 Công thức phân tử C25H34N6O3 Trọng lượng phân tử 466,583 Xuất hi...    Đọc thêm
2019-03-13 17:06:25
China Aphrodisiac Peptide Tăng trưởng tóc trắng Steroid PT141 Acetate CAS 32780-32-8 distributor

Aphrodisiac Peptide Tăng trưởng tóc trắng Steroid PT141 Acetate CAS 32780-32-8

Aphrodisiac Peptide Tăng trưởng tóc trắng Steroid PT141 Acetate CAS 32780-32-8 Chi tiết nhanh: Brasheranotide; PT-141 Số CAS: 32780-32-8 Moq: 20 lọ Độ tinh khiết (HPLC): 98,0% tối thiểu. Công thức phân tử: ...    Đọc thêm
2019-03-13 17:06:27
China Sức khỏe 99% Bột mọc tóc Dutasteride Avodart Anti-estrogen Steroid distributor

Sức khỏe 99% Bột mọc tóc Dutasteride Avodart Anti-estrogen Steroid

Sức khỏe 99% Bột mọc tóc Dutasteride Avodart Anti-estrogen Steroid Chi tiết nhanh: Tên sản phẩm; Dutasteride Bí danh; Avodart CAS số 164656-23-9 Công thức phân tử; C27H30F6N2O2 Trọng lượng phân tử; 528,53 Xuất ...    Đọc thêm
2019-03-13 17:06:20
China Tinh thể trắng Tăng trưởng tóc rắn Steroid Finasteride Proscar Anti-estrogen Steroid distributor

Tinh thể trắng Tăng trưởng tóc rắn Steroid Finasteride Proscar Anti-estrogen Steroid

Tinh thể trắng Tăng trưởng tóc rắn Steroid Finasteride Proscar Anti-estrogen Steroid Chi tiết nhanh: Tên sản phẩm: Finasteride Bí danh: Proscar CAS: 98319-26-7 MF: C23H36N2O2 MW: 372,55 Độ tinh khiết: 99,68% ...    Đọc thêm
2019-03-13 17:06:20
China 98319-26-7 Bột tăng trưởng tóc Finasteride Propecia Điều trị rụng tóc distributor

98319-26-7 Bột tăng trưởng tóc Finasteride Propecia Điều trị rụng tóc

98319-26-7 Bột tăng trưởng tóc Finasteride Propecia Điều trị rụng tóc Chi tiết nhanh: tên sản phẩm Finaster Số đăng ký CAS 98319-26-7 Công thức phân tử C23H36N2O2 Trọng lượng phân tử 372,5441 InChI : InChI = 1 ...    Đọc thêm
2019-03-13 17:06:02
China Chiết xuất thảo dược Potent Tăng trưởng tóc Steroid Minoxidil CAS 38304-91-5 distributor

Chiết xuất thảo dược Potent Tăng trưởng tóc Steroid Minoxidil CAS 38304-91-5

Chiết xuất thảo dược Potent Tăng trưởng tóc Steroid Minoxidil CAS 38304-91-5 Kính gửi, SMQ đã xuất khẩu như vậy sản phẩm trong 12 năm, chất lượng cao với giá tốt và phản hồi nhanh , vui lòng liên hệ với ycsmq...    Đọc thêm
2019-03-13 17:06:09
China Bột mọc tóc tự nhiên 57-85-2 Testoviron Testosterone Propionate Powder distributor

Bột mọc tóc tự nhiên 57-85-2 Testoviron Testosterone Propionate Powder

Bột mọc tóc tự nhiên 57-85-2 Testoviron Testosterone Propionate Powder 1. Chi tiết nhanh: Tên tiếng Anh: Testosterone Propionate Tên tiếng Anh: 17beta- (Propionyloxy) vàrost-4-en-3-one; 17beta-Hydroxy-4...    Đọc thêm
2019-03-13 17:06:15
Page 1 of 12 |< << 1  2  3  4  5  6  7  8  9  10  >> >|